Protein Info for CCNA_00201 in Caulobacter crescentus NA1000 Δfur

Annotation: outer membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 37 to 56 (20 residues), see Phobius details amino acids 68 to 86 (19 residues), see Phobius details PF13441: Gly-zipper_YMGG" amino acids 36 to 85 (50 residues), 43.3 bits, see alignment E=3.5e-15 PF13488: Gly-zipper_Omp" amino acids 41 to 90 (50 residues), 38.3 bits, see alignment E=1.5e-13 PF00691: OmpA" amino acids 120 to 216 (97 residues), 71.5 bits, see alignment E=9.5e-24

Best Hits

Swiss-Prot: 44% identical to YIAD_ECOLI: Probable lipoprotein YiaD (yiaD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_00201)

Predicted SEED Role

"Outer membrane lipoprotein omp16 precursor" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C5D4 at UniProt or InterPro

Protein Sequence (226 amino acids)

>CCNA_00201 outer membrane protein (Caulobacter crescentus NA1000 Δfur)
MPKFARKMTLAVVLMSAGALAACTTTDPYTGMPVRNNTGTGALTGAGVGAVLGYLTNTNK
GEQGRKNALIGAGIGALAGGAIGNYMDRQQADFRRSLEGSGVMIRRNGDQIVLVMPSDVT
FAVDRSDVQPPFTRVLDDVARTLNAYPQTTIDVVGHADSSGPDDYNQTLSERRASAVAGY
LTGPGGVLVDRVFVAGMGERAPIADNATADGRAQNRRVEIILRPLT