Protein Info for CCNA_00137 in Caulobacter crescentus NA1000 Δfur

Annotation: hybrid two-component histidine kinase/receiver protein ShkA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 514 PF00512: HisKA" amino acids 16 to 77 (62 residues), 65.4 bits, see alignment E=5.7e-22 PF02518: HATPase_c" amino acids 125 to 235 (111 residues), 85.3 bits, see alignment E=6.3e-28 PF00072: Response_reg" amino acids 382 to 491 (110 residues), 95.3 bits, see alignment E=4e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_0138)

Predicted SEED Role

"sensor histidine kinase/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C5A3 at UniProt or InterPro

Protein Sequence (514 amino acids)

>CCNA_00137 hybrid two-component histidine kinase/receiver protein ShkA (Caulobacter crescentus NA1000 Δfur)
MSDSRSDDRHPSVTPEQLATLSHEFRTPLNGVLGMARLLENTKLTAEQRSYVTALRESGD
HLLSLVNDVLHFARLGAAAIELSLAPVDIEGLLRQVAELMSPRAHEKGIEIAWAVSSPLP
TILADEGRLRQILLNFAGNAVKFTEAGGVLLTASAIDGGRVRFSVADTGPGVAPDARARI
FEAFVQTDVTHATQLGGAGLGLAIVSRLSAAMGGAVGVGGELGQGAEFWFEAPFATAAAP
LRAAPLEGRNVAIASPNAIVRAATARQIEAAGGRAYAAVDIASALAGAPADAVLLIDAAL
SGPRGALKPPAGRRSVVLLTPEQRDRIDRLKAAGFSGYLIKPLRAASLVAQVLQAVTADG
VAEDEPAHDDRIAGAVASGARVLLAEDNPINALLARTLLEREGCIVDRVADGEQAIAAAS
AGVYDLILMDLRMPGLTGIEAARALRAKGVATPIAALTADAFDEDRRTCLAAGMDDFLVK
PLTQEALRDALKRWTTGGVSGGWTKPATRAKVAG