Protein Info for CCNA_00091 in Caulobacter crescentus NA1000 Δfur

Annotation: transporter, drug/metabolite exporter family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 10 to 30 (21 residues), see Phobius details amino acids 41 to 58 (18 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 97 to 116 (20 residues), see Phobius details amino acids 125 to 143 (19 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details amino acids 181 to 205 (25 residues), see Phobius details amino acids 211 to 229 (19 residues), see Phobius details amino acids 239 to 259 (21 residues), see Phobius details amino acids 265 to 283 (19 residues), see Phobius details PF00892: EamA" amino acids 8 to 139 (132 residues), 49.7 bits, see alignment E=2.4e-17 amino acids 154 to 282 (129 residues), 59.8 bits, see alignment E=1.8e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_00091)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C575 at UniProt or InterPro

Protein Sequence (297 amino acids)

>CCNA_00091 transporter, drug/metabolite exporter family (Caulobacter crescentus NA1000 Δfur)
MTLSPNLRGALWMLASAVGFTVMTTLIKFLGDDYPAALQTFYRQLAGVLVLLPLIARDWR
GAFRTTRPGIVIFRSSAGVLALIMSFYAYQKLPLADANALSFTRTLWLVPLAGLVLREPI
GPRRISAALVGFVGVLIMLQPGAGGVEAWLGWPQLCALGAAFLFALTITGMKVMTRDHTP
FVLLVYAAVLGLVFAIPPALFVWRWPTWPDLGLLAAMGVIGTLTQGAYIKGMEAGEAAVM
APVDYTRLVFAVIVGFLLFQEVPRTATVVGAVIVVGSTLFISWREHQLAKQAAAEPT