Protein Info for CCNA_00073 in Caulobacter crescentus NA1000 Δfur

Annotation: HemY domain membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 44 to 66 (23 residues), see Phobius details PF07219: HemY_N" amino acids 26 to 133 (108 residues), 82.3 bits, see alignment E=2.5e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_0075)

Predicted SEED Role

"Uncharacterized protein EC-HemY, likely associated with heme metabolism based on gene clustering with hemC, hemD in Proteobacteria (unrelated to HemY-type PPO in GramPositives)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C3P8 at UniProt or InterPro

Protein Sequence (511 amino acids)

>CCNA_00073 HemY domain membrane protein (Caulobacter crescentus NA1000 Δfur)
MTRVAFALFLVAVVAVSVLALTGEPGRASMEWMGWRVEMTAAAAALLTLFSALMFTLLWR
GVIWIVEAPRRAARARAEAKRKQAIEALSRGFLAVAAGDGSEARRLAQKSSELAEDAPAL
VRVLAAQAAEAAGDRGAAKSAYNAMLGFPEMRLAGLRCLMLAAQAEGDRQTAIRHAETAY
GLARTARWAWRALLEARLEAGDWAAALQLVQGALERKIVSPVVAERSRAALLAASAASLV
NADDPKTRAQALDFATQSVKLKPDFAPGVVMAARLLAEDGKTAKAGGLIETAWKAEPHPA
LWLAYRDLKTNETPKARAQRLAALAAMKPEARESRLLRVESALIGGDPVAARAAARLLDD
EAPTARFAGLMARVAAANGDADEARAWIARGVAAPQEPDWSDLDPEGLAFAYQRDDWARL
AVSYAETGQLIHPRHERRERTMNDLPELPSAYAESTPFIRAAETGGALMPIPDDPGVYDA
PLVTDPPEGGPAPRRNSGARRRLPSGSRAAK