Protein Info for CCNA_00061 in Caulobacter crescentus NA1000 Δfur

Annotation: cytochrome p450

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 PF00067: p450" amino acids 293 to 392 (100 residues), 69.4 bits, see alignment E=1.3e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_0063)

MetaCyc: 66% identical to (S)-limonene 7-monooxygenase (ferredoxin) (Mycobacterium sp. HXN-1500)
1.14.15.M10 [EC: 1.14.15.M10]

Predicted SEED Role

"putative cytochrome P450 hydroxylase" in subsystem Nitric oxide synthase

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.15.M10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C2M5 at UniProt or InterPro

Protein Sequence (422 amino acids)

>CCNA_00061 cytochrome p450 (Caulobacter crescentus NA1000 Δfur)
MSDGSIDLKADARARAYSIPLEDYHVADPALFQADAMWPYFERLRKEAPVHYSKGDEEVG
PYWSVTRYNDIMTVDTTHQVFSSDAHLGGITIRNFDEDFVLPMFIAMDQPKHDIQRKTVS
PIVSPANLGRLEGIIRERVCGILDALPINEPFDWVDKVSIELTTQMLATLFDFPWEERRK
LTRWSDIATASPESGLIESEEARRAELLECLAYFTNLWNERVNLTEPGNDLISMLAHGEA
TRDMPPMEYLGNVILLIVGGNDTTRNSLTGGLYALSKNPQEEAKLRADPGLIPNMVSEII
RWQTPLAHMRRTALEDYELAGQTIKKGDKVVMWYVSGNRDDTVIENADQFIVDRPNARRH
LSFGFGIHRCVGNRLAEMQLKIVWEEILKRFPKIEVLEEPKRVYSTFVKGYERMMVRIPE
RI