Protein Info for CCNA_00056 in Caulobacter crescentus NA1000 Δfur

Annotation: ribosomal-protein-S18-alanine acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 PF00583: Acetyltransf_1" amino acids 14 to 122 (109 residues), 59.6 bits, see alignment E=7.5e-20 PF13508: Acetyltransf_7" amino acids 51 to 122 (72 residues), 35.6 bits, see alignment E=2e-12 PF13673: Acetyltransf_10" amino acids 55 to 126 (72 residues), 29.7 bits, see alignment E=1.1e-10 PF08445: FR47" amino acids 66 to 125 (60 residues), 30.3 bits, see alignment E=6.8e-11

Best Hits

KEGG orthology group: K03789, ribosomal-protein-alanine N-acetyltransferase [EC: 2.3.1.128] (inferred from 100% identity to ccr:CC_0058)

Predicted SEED Role

"Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.-)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Ribosome biogenesis bacterial (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-, 2.3.1.128

Use Curated BLAST to search for 2.3.1.- or 2.3.1.128

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C3N4 at UniProt or InterPro

Protein Sequence (150 amino acids)

>CCNA_00056 ribosomal-protein-S18-alanine acetyltransferase (Caulobacter crescentus NA1000 Δfur)
MNLRPVGSEAAFDLADLHDKAFDRPWTALEFDDLLKSPGAFAILGEAGEPAEAKGFILCR
SIAGEAEILTVAVDPAARRRGWGAALVEVAAGIAAETKAEAMFLEVAADNLAAIALYQTT
GFLKVGLRKGYYPHPDGAKDALVMRRALNT