Protein Info for CCNA_00028 in Caulobacter crescentus NA1000 Δfur

Annotation: TonB-dependent receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 773 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details PF07715: Plug" amino acids 77 to 175 (99 residues), 72.4 bits, see alignment E=4.2e-24 TIGR01783: TonB-dependent siderophore receptor" amino acids 79 to 772 (694 residues), 245.8 bits, see alignment E=5.2e-77 PF00593: TonB_dep_Rec_b-barrel" amino acids 249 to 742 (494 residues), 186 bits, see alignment E=2.4e-58

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 100% identity to ccs:CCNA_00028)

Predicted SEED Role

"Ferrichrome-iron receptor" in subsystem Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C5S7 at UniProt or InterPro

Protein Sequence (773 amino acids)

>CCNA_00028 TonB-dependent receptor (Caulobacter crescentus NA1000 Δfur)
MRNPNFTGVVSRPRRALSIAAVAGVAGLGLAQAAVAGPDSADAAVTTANADDRSVSSVTI
DAKRVADPSSSKFTAPLVDTPKSVTVIPAKIIEQTAATSLADILRTSPGITFGAGEGGQP
LADRPFIRGQASANNVFVDGVRDSGGQVREIFNLEQVEVVKGPDSAYGGRGSGGGSINLS
SKSPKADSFARGSVGVGTDAYVRATADLNHALNESVAVRLNLLATQGDTPGRKSVSFDRW
GVAPSLAIGLDGDTQLTASYYHLEGDQTPDYGVPLLTKTTQPRTASGILDVDRRSFYGVA
SRDYQKTKSDIATFAIDHRIDETLNLRQVVRYSKSLNDYIVTNPGDGGAAQFVQGQWWMK
RGTKTRWNPTETVAAVTDLHGKKTFLGLEHSFDVGLELSREENLNATYSTFTTSGAACPT
GFTIAATTLASLGAGDCTLVYKPNDKDAWTGVINRAPAARNVAKTTALYGFDTVKFGEKV
LLNLGLRHDRYESKGVDVATTQANGVFTSVTYTPRSGSWAFTNYQVGLVYKPTPGSSLYV
SYSTASTPPGISAGDQNSNTATGTGNLATVQLEPEDSESFEAGAKANVFHDTLALSAALF
QTSRKNAQIQIDATTYAQVGEVEVKGFEFGVSGNITPKWQVFGGYTYMDSELVRGAYTSV
NQGDPLANTPKHSISSFTTYKVTRKIALGGGAYHVSKSFGGNQGGAGGGASRIYAPAYWR
YDAFASWAVSTGVDLQLNIQNLTDERYIARTNGVHHADPAPGRQAILTINVKY