Protein Info for CCNA_00026 in Caulobacter crescentus NA1000 Δfur

Annotation: PAS-family sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 PF13188: PAS_8" amino acids 22 to 70 (49 residues), 19.8 bits, see alignment 2.6e-07 amino acids 266 to 318 (53 residues), 20.4 bits, see alignment 1.7e-07 TIGR00229: PAS domain S-box protein" amino acids 23 to 134 (112 residues), 57.6 bits, see alignment E=7.1e-20 amino acids 263 to 384 (122 residues), 51.5 bits, see alignment E=5.5e-18 amino acids 392 to 514 (123 residues), 32.1 bits, see alignment E=5.3e-12 PF00989: PAS" amino acids 25 to 124 (100 residues), 43.3 bits, see alignment E=1.5e-14 amino acids 267 to 370 (104 residues), 23.4 bits, see alignment E=2.2e-08 PF08448: PAS_4" amino acids 25 to 126 (102 residues), 31.6 bits, see alignment E=7.8e-11 amino acids 272 to 378 (107 residues), 59.4 bits, see alignment E=1.8e-19 PF13426: PAS_9" amino acids 32 to 125 (94 residues), 30.6 bits, see alignment E=1.5e-10 amino acids 277 to 376 (100 residues), 17.1 bits, see alignment E=2.5e-06 PF08447: PAS_3" amino acids 42 to 110 (69 residues), 41.4 bits, see alignment 6.7e-14 amino acids 162 to 233 (72 residues), 31.9 bits, see alignment E=5.7e-11 amino acids 416 to 500 (85 residues), 34.7 bits, see alignment E=7.9e-12 PF00512: HisKA" amino acids 527 to 592 (66 residues), 59.2 bits, see alignment 1.5e-19 PF02518: HATPase_c" amino acids 638 to 750 (113 residues), 91.3 bits, see alignment E=2.5e-29 PF00072: Response_reg" amino acids 773 to 885 (113 residues), 88.7 bits, see alignment E=1.3e-28

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_00026)

Predicted SEED Role

"FIG00483010: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C4A7 at UniProt or InterPro

Protein Sequence (900 amino acids)

>CCNA_00026 PAS-family sensor histidine kinase (Caulobacter crescentus NA1000 Δfur)
MSQASTPEPAPASSFGEGEAARWFFDNASDLFTVISAEGRFISVNDAWSHLTGWARDELV
GQPTIKFVHPDSQAELVDTGRRLRQTGSAINELKIRCKDGRWIWLQGRSRLGPHGEMVGV
MHDISAEVEARLELEAARRTQALLAEKAGIGVWSYEPETQRIDWAPDALALMGVSPEDIA
TPELFLARLPENHRAEVQAAFVHAARTGEGGTLEYRLRANDGRWFTLRATYRTEARPGSG
FALKGVSQNITDVARSRDKAIWSERRARRLIEDAPFAVAVYDVDMRLRMVSPRFLEIFRS
TEAQVIGKTLTELTNGTRRRFVNRVARALSGEVVTRREDRLYDAEGVERAFRWEARPWRD
VAGEIVGVITYMDEITALTEARREARNNARRLKVALGAARAGVYEIDHEKQAFWGSPEFH
RMMGRRIEYQDVREGIWPMVHPEDLTQLYETAATWRREGRRTPQEHEVRLLSPGGEARWA
RVFHEVRRDGQGKALKAVGLILDIDEKKKAELALIEAERAAQAANEAKAQFLANMSHEIR
TPMNGVLGVMHVLKRELPPGDSASLLNEALAAGQMLSTLLDDVIDISRIEAGRLDLNHEP
VDPRDLVRGVARLLATQAAHKGLRLELDLPDDLGWIETDPTRVRQALFNLIGNAVKFTLK
GSVTVRAQRRITDAGPYLVFDIIDTGVGVPLEAQKRLFERFQQADAGTTRRFGGSGLGLA
ITRKLARMLGGEVSFRSVPGEGSTFSLTIAAPPVGPPSAQAGETSELLTSLKVLVVEDNP
TNQLVARRILEQLGAEVSVADDGAAGVEAAERGRFDLILMDVQMPGMDGLEAARRIRALP
GPAGRAPIIALTANVMAHQRAAYRAAGMDGVAAKPISPAALVAEILRLSRIEPDPRCAVA