Protein Info for CCNA_00024 in Caulobacter crescentus NA1000 Δfur

Annotation: uroporphyrin-III C-methyltransferase/Precorrin-2 dehydrogenase/Sirohydrochlorin ferrochelatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 PF13241: NAD_binding_7" amino acids 7 to 97 (91 residues), 44 bits, see alignment E=4.3e-15 TIGR01470: siroheme synthase, N-terminal domain" amino acids 51 to 189 (139 residues), 116 bits, see alignment E=8.9e-38 PF10414: CysG_dimeriser" amino acids 133 to 189 (57 residues), 42.3 bits, see alignment E=7.8e-15 PF00590: TP_methylase" amino acids 203 to 269 (67 residues), 29.5 bits, see alignment E=1.1e-10

Best Hits

KEGG orthology group: K02304, precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC: 1.3.1.76 4.99.1.4] (inferred from 100% identity to ccs:CCNA_00024)

Predicted SEED Role

"Siroheme synthase / Precorrin-2 oxidase (EC 1.3.1.76) / Sirohydrochlorin ferrochelatase (EC 4.99.1.4)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 1.3.1.76, EC 4.99.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.76 or 4.99.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C2J6 at UniProt or InterPro

Protein Sequence (296 amino acids)

>CCNA_00024 uroporphyrin-III C-methyltransferase/Precorrin-2 dehydrogenase/Sirohydrochlorin ferrochelatase (Caulobacter crescentus NA1000 Δfur)
MDSFPAFFPLAGRKVVIAGSGEAAEAKARLFDGSPATLVRLDGHAAYLPGSYSGAAFAFI
ASSDEVFVQAAAGAARAARVLVNVVDRPELCDFNTPAVIDRGQVVAAVGTGGGAPVLATM
LRNDIEAQVPEGTGRVAALLAKFQTEVRKTLPALHERRAFLRDAVMGEAAAAAREGDMDR
AGQLFREALAKGGARKGVVRFIAGKGPADLLTLRALRALGSADVLVLDGDVEPEVLKMAR
RDAERLDADGADAPHLIQLAREGRQIVRLITHPVDPALVHALTQAEVAVEVLPVAT