Protein Info for CCNA_00008 in Caulobacter crescentus NA1000 Δfur

Annotation: chromosome replication initiator protein DnaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 490 PF11638: DnaA_N" amino acids 25 to 86 (62 residues), 57.5 bits, see alignment E=2.3e-19 TIGR00362: chromosomal replication initiator protein DnaA" amino acids 27 to 488 (462 residues), 453.4 bits, see alignment E=4.8e-140 PF00308: Bac_DnaA" amino acids 149 to 370 (222 residues), 294.2 bits, see alignment E=1.9e-91 PF01695: IstB_IS21" amino acids 184 to 283 (100 residues), 41.6 bits, see alignment E=2.6e-14 PF00004: AAA" amino acids 185 to 269 (85 residues), 34.3 bits, see alignment E=7.7e-12 PF08299: Bac_DnaA_C" amino acids 399 to 467 (69 residues), 99.7 bits, see alignment E=2e-32

Best Hits

Swiss-Prot: 100% identical to DNAA_CAUVC: Chromosomal replication initiator protein DnaA (dnaA) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02313, chromosomal replication initiator protein (inferred from 100% identity to ccr:CC_0008)

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8GWW5 at UniProt or InterPro

Protein Sequence (490 amino acids)

>CCNA_00008 chromosome replication initiator protein DnaA (Caulobacter crescentus NA1000 Δfur)
MTMKGGVASQDFSAAIATACEPAANVWSKVCVALKRELGDAAFGSWIAPAMLREAATGDV
VLVTSTGIARDWIRRSAWRRIGELWAAHDATGRRIDLKSRLEFEAAAGAYVEATPKAVAA
EPIEIVLPVSTDAPTVVAPSAKSPRTQGLQERFTFETFVPGPANEFAHAVARRIANWADG
HFNPVLFHGPYGFGKTHLLNALAWEAMRNAPEKRVVYLTAERFLSTFVRAVMDRQTAAFK
EELRAADLLIIDDVHFIAGKQSTQEELFHTLTALVGEGGRVVFSADRPPSAMTEMDAHLR
SHLSAGLVCGLEPADRNLRLGILERKIQTLGAAHGFEPSIRPEVMQFLADRFTDSVRELE
GALNTLSARAGEGLSRMTLDEVQAILRPHLRSGEKRITIDDIQKATAEHYGMKQADLLSE
RRNRAVARPRQAAMWLAKQLTTRSLPDIGRRFGGRDHTTVLHAVRRIEALRAEDSALSHD
LETLTRKLRG