Protein Info for CCNA_00002 in Caulobacter crescentus NA1000 Δfur

Annotation: septum formation protein Maf

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 PF02545: Maf" amino acids 6 to 192 (187 residues), 139 bits, see alignment E=7.3e-45

Best Hits

Swiss-Prot: 100% identical to NTPP_CAUVC: Nucleoside triphosphate pyrophosphatase (CC_0002) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K06287, septum formation protein (inferred from 100% identity to ccs:CCNA_00002)

Predicted SEED Role

"Septum formation protein Maf" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C5Q9 at UniProt or InterPro

Protein Sequence (199 amino acids)

>CCNA_00002 septum formation protein Maf (Caulobacter crescentus NA1000 Δfur)
MSLTPVTLASQSSARQMILKNAGVAFEAVSPGVDEDAAKAGLLAEDVTPRDIADALAEMK
AVKVSTKRPGLVIGADQTLDLKGRLIDKAGSLDEARARLLELRGTTHKLHSAVVVARDGR
PIWRIVESAKLSVRPFSDAWLDRYIERRGEALLWSVGCYELESEGVQLFDKIEGDYFTIL
GLPLVGLLDFLRLHGALTV