Protein Info for CA264_21445 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: metal transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 634 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 58 to 80 (23 residues), see Phobius details amino acids 115 to 133 (19 residues), see Phobius details amino acids 450 to 467 (18 residues), see Phobius details amino acids 474 to 494 (21 residues), see Phobius details amino acids 500 to 524 (25 residues), see Phobius details amino acids 563 to 581 (19 residues), see Phobius details amino acids 587 to 613 (27 residues), see Phobius details PF00873: ACR_tran" amino acids 3 to 615 (613 residues), 430.5 bits, see alignment E=6.3e-133

Best Hits

KEGG orthology group: K07787, Cu(I)/Ag(I) efflux system membrane protein CusA (inferred from 75% identity to shg:Sph21_0288)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcA; Cation efflux system protein CusA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YZH5 at UniProt or InterPro

Protein Sequence (634 amino acids)

>CA264_21445 metal transporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MNMKLSKEDRIRIIEKSSRQVGPSVFWSTVIIIASFLPVFLLTGQEGKLFGPLAWTKTFI
LIVDAVVAITLTPVLISFFLKGKFKEESANPINRGLEKVYGPILKWCLKWRKTTLGVNIL
ALAVSIPMLFSLGTEFMPPLDEGSILFMPVTLPDISNAEAKRILQVQDKIIKSVPEVESV
LGKAGRASTATDNSPISMIETIIMLKPESEWREGITKQDIIQELDAKLQIPGVVNGWTQP
IINRINMLATGIRTDVGVKVYGQNLDSIAAVSEKVRTALNGIPGVNDLYVEPITGGKYLE
IDINREALGRYGLTVDDVNMIVESALGGTPIGNTIEGRERFSINVRLAQEYRNSVERIER
IPIQTSSAGTVPLSSVATVRFTDGPPMINSENAQLRGAVLFNVRDRDLGSTVQEAIEKIN
TEVTGIPDGYYLEWSGQWENQVRANNTLKIIIPLVLVIILLILYFSFKSMKEALINLGTI
PFALIGGVYIVYFYGVNLSVAVAVGFIALFGLAMETSMLMIVYLNEAMQQLVAIKGNSSD
TITKQDIRDYVFMGAAKRLRPKIMTVSVSLFGLVPVLWATGVGSDIMLPIVLPLIGGVLT
SSIHILLVTPVVFEMTKEYELRKHGKLEIYDVKH