Protein Info for CA264_21270 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 604 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF19335: HMBD" amino acids 47 to 72 (26 residues), 45.8 bits, see alignment (E = 1.2e-15) TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 97 to 396 (300 residues), 143 bits, see alignment E=5.3e-46 PF16576: HlyD_D23" amino acids 108 to 317 (210 residues), 245.5 bits, see alignment E=9e-77 PF13533: Biotin_lipoyl_2" amino acids 127 to 169 (43 residues), 27.3 bits, see alignment 6.2e-10 PF13437: HlyD_3" amino acids 214 to 312 (99 residues), 60.8 bits, see alignment E=4.9e-20 PF11827: DUF3347" amino acids 467 to 558 (92 residues), 70.1 bits, see alignment E=5.6e-23

Best Hits

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YZD6 at UniProt or InterPro

Protein Sequence (604 amino acids)

>CA264_21270 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MWYFGLGFLVLGLLLGWMFFGGEAEAPVTEENTEMAHEHGGEEGTIWTCAMHPQIRMNEP
GKCPICGMDLIPLQEGGATVSLNEIQMTEEAMQIANVQTVAVQRGEPTKEIYLPGKVKAE
ETAVGDITARFPGRIERLYVNFTGQEVKKGQLLASIYSPELITAQKELQVAARLRESNPS
FYESAVRKLKLWNISDAQIRRIASGGKLQDNLNIYATQSGTVVSKNVNEGEYVKEGQPLF
QVAGLSDVWVVFDAYESDLPWIEVGDEIKFTVQSLPGEEFTSKVTFIDPVINPGTRAASV
RTEVKNSNGKLKPDMFAQGVLQSDLDVASSGLLIPKTAVLWTGKRAVVYVKNPAFEQPTF
EFREVQLGPEAGDRYVVNSGLKPGEEIVANGVFKVDAAAQLQGKVSMMNPNADPGAAGGA
MAGMPGMDMPGTEANLSQTPTSKFVEGDAVDFRGKVPAAFTKQLNDVVDAYLLLKNALVE
ADEKETAKYSTALLAALNKVDDKLLKGDAKAFWEEKKSFLFQHARLCKEADTIEGKRENF
IFLSQPLIKIVEAFGARQTLYVDFCPMAKGGEGAYWLSDTKEIRNPFMGKKMLTCGEVKD
VIKP