Protein Info for CA264_21210 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: SOS mutagenesis and repair protein UmuC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 PF00817: IMS" amino acids 8 to 152 (145 residues), 127.2 bits, see alignment E=9.9e-41 PF11799: IMS_C" amino acids 245 to 360 (116 residues), 86.6 bits, see alignment E=3.1e-28 PF13438: DUF4113" amino acids 372 to 421 (50 residues), 56.5 bits, see alignment 4.5e-19

Best Hits

Swiss-Prot: 45% identical to UMUC_SALTY: Protein UmuC (umuC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03502, DNA polymerase V (inferred from 51% identity to chu:CHU_1492)

Predicted SEED Role

"Error-prone, lesion bypass DNA polymerase V (UmuC)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YYL8 at UniProt or InterPro

Protein Sequence (422 amino acids)

>CA264_21210 SOS mutagenesis and repair protein UmuC (Pontibacter actiniarum KMM 6156, DSM 19842)
MTSLFALVDCNNFYCSVIRVFHPELNNVPVVVLSNNDGSIIARSNEAKALGLQMGQPFFE
AKTTIDKYNVVYFSSNYTLIGDMSARVHSTLARFTPNVEIYSIDEAFLDLGGFKGIVIPD
YARTIRNTVKKWTGIPVSIGVAPTKTLAKLANRIAKKSEKANGVLVLTEAKHLEAALKRT
DVGDVWGIGSRYATKLHSFGINNAWQLANVTDAFAKKHLTVVGLRLVKELRGEPCADLEI
EPPAKKGICSSRSFGKPVTTLDDLKEAVAVYASRCAYKLRQQKSACRVVTVFIHTNPFRE
QEPQYYNTKTINLPVSSSSTIELVQYATMALEHIYRDGFAYKKAGVYITEIGPADGAQMN
IFDRVDRSKHASLMLTLDQLNKSMGKGTVKVAAEGVSHIWEPKAEFSPPCYTTRIEDVLK
VR