Protein Info for CA264_21135 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: cation transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 50 to 67 (18 residues), see Phobius details amino acids 79 to 103 (25 residues), see Phobius details amino acids 119 to 138 (20 residues), see Phobius details amino acids 150 to 172 (23 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 14 to 289 (276 residues), 302.9 bits, see alignment E=1.1e-94 PF01545: Cation_efflux" amino acids 18 to 208 (191 residues), 167.9 bits, see alignment E=2.4e-53 PF16916: ZT_dimer" amino acids 212 to 288 (77 residues), 54.1 bits, see alignment E=1.3e-18

Best Hits

Swiss-Prot: 50% identical to CZCD_CUPMC: Metal cation efflux system protein CzcD (czcD) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)

KEGG orthology group: K03295, cation efflux system protein, CDF family (inferred from 55% identity to oca:OCAR_6432)

MetaCyc: 42% identical to Zn2+/Cd2+/Ni2+/Cu2+ exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-200

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YZF1 at UniProt or InterPro

Protein Sequence (298 amino acids)

>CA264_21135 cation transporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MAHGHAVSASSQNKGRLKLVLTFTLLYMIAEVVGGLLTGSLALLADAGHMLTDVGGLAFA
LIAIMLAERPASPERTYGYYRAEILAALANAVILIGISLYILYEAYQRFLDPPEVESKAM
LLVATIGLVVNLAGMYILRKGSQESLNMKGAYFEVLSDMLTSVGVIIAGVIMWTTGWYYA
DPILSAGIGLFILPRTWVLLKEAVGVLLEGTPSDVNIEELRKSIAALEGVEEVHDLHVWS
LTSGVNAMSAHVVVATDNSALNNEMLKRISQDVTSRFKISHTTVQLESRGYEENETHL