Protein Info for CA264_21120 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: ZIP family zinc transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 35 to 57 (23 residues), see Phobius details amino acids 65 to 87 (23 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 127 to 144 (18 residues), see Phobius details amino acids 165 to 186 (22 residues), see Phobius details amino acids 192 to 213 (22 residues), see Phobius details amino acids 225 to 244 (20 residues), see Phobius details PF02535: Zip" amino acids 100 to 241 (142 residues), 46.5 bits, see alignment E=1.5e-16

Best Hits

KEGG orthology group: K07238, zinc transporter, ZIP family (inferred from 52% identity to aau:AAur_pTC10200)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YZ85 at UniProt or InterPro

Protein Sequence (246 amino acids)

>CA264_21120 ZIP family zinc transporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MNDYLQVLLYAAMPALGNFFGGVLAEVFKVSEKTLSLALHTAAGIVLAVIGLELMPQALE
AEQPFIPVLAFVAGSVFFVFLDQGVGYVQSRFGGESKKGMSAAIAIYIGVAIDLFSDGIM
IGTGSTVAASLGLLLAIGQVPADIPEGFATIATFKSKGVKRGKRLLLSASFAIPIFLGAT
VGYWGVKDSKEVVKLSLLAFVAGILLTVSIEEMLTEAHDRPDSKWAAFALAGGFALFTLL
AVYLEE