Protein Info for CA264_21035 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: mobilization protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 655 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 52 to 76 (25 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 123 to 143 (21 residues), see Phobius details PF14293: YWFCY" amino acids 41 to 145 (105 residues), 28.7 bits, see alignment E=2.5e-10 PF02534: T4SS-DNA_transf" amino acids 188 to 564 (377 residues), 74.5 bits, see alignment E=1.7e-24 PF10412: TrwB_AAD_bind" amino acids 422 to 575 (154 residues), 47.2 bits, see alignment E=3.1e-16 PF12696: TraG-D_C" amino acids 459 to 574 (116 residues), 54.8 bits, see alignment E=1.9e-18

Best Hits

KEGG orthology group: None (inferred from 59% identity to bfs:pBF9343.18c)

Predicted SEED Role

"Putative mobilization protein BF0133" in subsystem Conjugative transposon, Bacteroidales

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YYS3 at UniProt or InterPro

Protein Sequence (655 amino acids)

>CA264_21035 mobilization protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MEESSEIKKLYSFLQGLIYFTIVVEIAVFLFMDSGSMYQLQPVLRKVKGMAIYEHIYFSK
AFTFGMILIVSIGTKARKNLDLDPLRHIFLPLLIGCAFFFGSGFFYFFESSRILFWEVSL
SDAAYILLSFLGAMMIHIALDNISKHIQHRLMKDKFNVENESFEQSSKPVHTPYSVNIPM
LYYYQKRIQRGWLNVVNPFRATLLIGTPGSGKSFSVVLPFIKQLLGKGFSMMVYDFKFPD
LARTTYYHYLVNRKRGVLKNHRFHVINFNSVEHSRRFNPLKPEYLPTLADATETAEALLE
ALRKGDRDSGTAQFFNQSAVNFLASCIYFLSRHEGGLYSSFPHVLSFINLSYDQIFEVLF
SEPELESLLSPFATAYKNRAFEQLEGQIGTLKINIGRLATKETFWVLSGDDFNLKITDPE
NPSVLVIANDPATQSINSACNALILNRMTRLINTKGNLPCGLIVDESPTLYIHRVENLIA
TARSNKIAVLLGLQELPQLRQQYGRETADTICSVAANVLSGSARNKETLDWLEKLFGRVR
QLKEGLSVDRNRTSVNMNEELGPLIPASKIANLQAGELVGQVASDSEAYSGKYVAGTYHC
KINLNLDNIQLEEKQYLDLPKFYNFGTPDQKDQILRANYNKIRNEVKTLITALQV