Protein Info for CA264_21005 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: plasmid transfer protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 transmembrane" amino acids 24 to 45 (22 residues), see Phobius details amino acids 64 to 84 (21 residues), see Phobius details amino acids 159 to 181 (23 residues), see Phobius details amino acids 189 to 213 (25 residues), see Phobius details amino acids 225 to 249 (25 residues), see Phobius details amino acids 270 to 298 (29 residues), see Phobius details amino acids 304 to 304 (1 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 51% identity to bsa:Bacsa_3655)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YYZ1 at UniProt or InterPro

Protein Sequence (331 amino acids)

>CA264_21005 plasmid transfer protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MRELIDKAIFDLFDGLFLNIQELVSVFLYDAQALCAISMLLYFGLEAYKMMAGDETLRIM
PLLRPFALTLVIVFWPGFIDAVNLPLQLVNDQAKGMYGAQVDQVEDLHRERLALVDSVAR
KLSESSAEFERIESEASDASWYETMGIDLQPLFNKMKGYYLMLMAKLHFTAMMVVEWVVI
SIFQVCSYIIYFLQIIFAGILVILGPFSFALSVLPGFRDSYLAWIARYISVGLYSGLGYI
IMSISFVLVKYGLMKEIDILKAVLGNEEMFIAYVSFPSGGISFYIVSLIVGGLAMLTIPI
ISTWIVHTTGVGNAIGTMAGGAAKAAGGILK