Protein Info for CA264_20770 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 654 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 201 to 222 (22 residues), see Phobius details PF00970: FAD_binding_6" amino acids 300 to 396 (97 residues), 54.4 bits, see alignment E=2.8e-18 PF00175: NAD_binding_1" amino acids 407 to 513 (107 residues), 65.6 bits, see alignment E=1.2e-21 PF00111: Fer2" amino acids 577 to 647 (71 residues), 52 bits, see alignment E=1.1e-17

Best Hits

Predicted SEED Role

"Flavodoxin reductases (ferredoxin-NADPH reductases) family 1" in subsystem Anaerobic respiratory reductases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YYZ8 at UniProt or InterPro

Protein Sequence (654 amino acids)

>CA264_20770 oxidoreductase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKSFHALVPFFLSAAVLVAAACPAVSQVPPGEHNSHHPQQSSPTADSAATDTSSGRGMPG
GKADGTNSGMGGMGEMMQDMGKPPGKELYPSLMQLPDLSPERRAKISQLANERIDRGNTL
LSLGLQKLRDAAGSQYFAGIQEANEQIRAGQALVQSGLAAQQALAENKNPREIALKWFRQ
EMNLTPYQEVEPPHGFFGLSWFHYLTMLVFAAFAVAMIWMYFHKMKRANALIEKLAGKSP
EKIPAPGEAKPVAPPPAKGEPAPNAEPAKGEPVTAKGTPPLVGPGLAPSKPNSWTGTLLV
TEIFDETPNVKTFRLTDPAGGKLPFNFLPGQFITITINLKGVPVKRSYTIASSPTRRDYC
EITVKHEEKGTVSHYLHTEVHIGELLQFTAPSGKFTFTETHAESAVFIAGGVGVTPMMSA
IRYLTERSWKSEIFFFFTCKNESSIIFREEILYLQKRYPNLHVWFLLEEPVSNPTDSFIK
GRITKEILAERVPDIITRMIHICGPPPMMNAVKEMLDELKVPKEMVMTEVFAGPPPKPKT
VSPTPEEKGKPPVDEEVAKPFTSEEAGKTGVVTFAKSNKTAVLTPDKSILEASEEVGVNI
DYSCRVGTCGICKIKLNSGKVTMAVEDALTEDDKTQNMILACQAKATEDVSVDA