Protein Info for CA264_20705 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: N-acyl-L-amino acid amidohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR01891: amidohydrolase" amino acids 48 to 426 (379 residues), 336 bits, see alignment E=1.5e-104 PF01546: Peptidase_M20" amino acids 105 to 433 (329 residues), 137.9 bits, see alignment E=4.5e-44 PF07687: M20_dimer" amino acids 232 to 326 (95 residues), 49.6 bits, see alignment E=3.4e-17

Best Hits

Swiss-Prot: 38% identical to YHAA_BACSU: Putative amidohydrolase YhaA (yhaA) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 64% identity to sli:Slin_0207)

MetaCyc: 38% identical to N-acetyl amino acid acetylase (Bacillus subtilis subtilis 168)
3.5.1.-

Predicted SEED Role

"N-acetyl-L,L-diaminopimelate deacetylase (EC 3.5.1.47)" in subsystem Lysine Biosynthesis DAP Pathway (EC 3.5.1.47)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.47

Use Curated BLAST to search for 3.5.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YXL5 at UniProt or InterPro

Protein Sequence (444 amino acids)

>CA264_20705 N-acyl-L-amino acid amidohydrolase (Pontibacter actiniarum KMM 6156, DSM 19842)
MIRTYTLKQRAILAAAGFTLLSAPTIAQDTKLMAKASTLADKVEPQVIEWRRHFHEHPEL
SNRETETAARIAAELKKMGIEVETGVAKHGVVGILKGGKPGPVVALRADIDGLPVTERAN
IPFASKAKGTYNGNEVGVMHACGHDTHIAMLLGAAEVLSSMKNDLKGTVKFLFQPAEEGA
PAGEEGGARLMVKEGVLEKGPKPEVIFGLHINSQTEVGTLKYRPGGIMAGADVFRIKVKG
KQVHGANPWAGVDPIVVSSQIIYGLQTIISRQTELTEDAAVITVGMIHGGVRNNIIPEEV
QMEGTIRTLDKEMQKKIHDKIRLTATNIAESAGATAEVEIEEMAAITYNEPALTEKMLPT
LQATAGKGKVVLMNAMTGAEDFSYFQQEIPGLYLFVGGMPKGQNPAKAPAHHTPDFYVDE
SGMKLGVKTLTNLTLDYMNGKGKR