Protein Info for CA264_20595 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: acyl-CoA desaturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 40 to 60 (21 residues), see Phobius details amino acids 131 to 159 (29 residues), see Phobius details PF00487: FA_desaturase" amino acids 6 to 229 (224 residues), 55.3 bits, see alignment E=4.3e-19

Best Hits

KEGG orthology group: K00507, stearoyl-CoA desaturase (delta-9 desaturase) [EC: 1.14.19.1] (inferred from 68% identity to dfe:Dfer_0451)

Predicted SEED Role

"Fatty acid desaturase (EC 1.14.19.1); Delta-9 fatty acid desaturase (EC 1.14.19.1)" (EC 1.14.19.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.19.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YY13 at UniProt or InterPro

Protein Sequence (256 amino acids)

>CA264_20595 acyl-CoA desaturase (Pontibacter actiniarum KMM 6156, DSM 19842)
MAILIFFVVHWYLSLFVQTFYLHRYAAHKMFTMTPFWERAFYLLTYIAQGSSFLSPRAYA
ILHRMHHAFSDTERDPHSPHFSNNAFTMMWKTKEIYNDVLNKRVEPERRFEGDYPIWPAL
ERIGDSYFSRIGWGVAYVLFYIAFATQWWMFLLLPIHFLMGPVHGAIVNWSGHKYGYQNF
DNNDKSRNSLFFDFLTGGELFQNNHHKLPNRVNFGVKWWEVDPTWPVIWTLDKLSIIKLK
PVKVKAAKVPRVKANA