Protein Info for CA264_20545 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 TIGR01777: TIGR01777 family protein" amino acids 5 to 296 (292 residues), 328.8 bits, see alignment E=1.9e-102 PF01370: Epimerase" amino acids 5 to 224 (220 residues), 73.9 bits, see alignment E=2.1e-24 PF08338: DUF1731" amino acids 253 to 298 (46 residues), 59.9 bits, see alignment 2.4e-20

Best Hits

Swiss-Prot: 37% identical to YFHF_BACSU: Epimerase family protein YfhF (yfhF) from Bacillus subtilis (strain 168)

KEGG orthology group: K07071, (no description) (inferred from 52% identity to mtt:Ftrac_2259)

Predicted SEED Role

"Cell division inhibitor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YY03 at UniProt or InterPro

Protein Sequence (305 amino acids)

>CA264_20545 epimerase (Pontibacter actiniarum KMM 6156, DSM 19842)
MPGKILITGGSGLVGMRLSEMLIDQGYEVAHLSRRPDKVSTYKTFKWDIEAGYIDESAIS
YADYIVNLAGASVSSDKWSEERKREILHSRTDSLHLLQKCLSQSEHHVKGLLSASAIGIY
GDSGDQLVSEESTYADDFLAEVCKAWEAAAWQVRDLGIRTVIFRLGIVLSVKGGALPQIA
RPVKMMAGAPLGSGKQYMSWIHIDDACRLFIQAIEAPQFEGVYNAVAPHPVTNKEFTKEL
AEAMKKPLVLPKVPAFAINLMMGEMSEVILASQRVSANKVLHTGFTFEYSYLEEALESFY
EEEED