Protein Info for CA264_20525 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: prenyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 49 to 67 (19 residues), see Phobius details amino acids 96 to 125 (30 residues), see Phobius details amino acids 146 to 166 (21 residues), see Phobius details amino acids 177 to 197 (21 residues), see Phobius details amino acids 218 to 240 (23 residues), see Phobius details amino acids 246 to 266 (21 residues), see Phobius details amino acids 286 to 301 (16 residues), see Phobius details PF01040: UbiA" amino acids 33 to 271 (239 residues), 84.8 bits, see alignment E=3.1e-28

Best Hits

KEGG orthology group: K02548, 1,4-dihydroxy-2-naphthoate octaprenyltransferase [EC: 2.5.1.- 2.5.1.74] (inferred from 39% identity to hhy:Halhy_0926)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-, 2.5.1.74

Use Curated BLAST to search for 2.5.1.- or 2.5.1.74

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YXW9 at UniProt or InterPro

Protein Sequence (302 amino acids)

>CA264_20525 prenyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MQPPVNLTAKPLKHTKQYSSALTLMRIPFSVYLMPVFWFALSTLQQVDVWRAAMVFLILH
VFVYPASNGYNSYYDRDEGSIGGLKNPPRVNRQLMHLVLLFDVCAVLLGLLLSPLFACLV
ALYLLISKAYSYEGIRLKKHPVASTFVVTFFQGAFTYAMVQVGVGLSLPQVLKTPNVWFA
LVSTLFLCGSYPLTQIYQHEEDSRRGDRTLSLLLGIKGTYLFAALSLLAGAALLLWLYFA
MNQMRSIFIFLTCTAPILYFFTGWVLRAQHDLRVVNYENTMRMNKISSLCISAAFVAIML
AN