Protein Info for CA264_20465 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: aspartate carbamoyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 85% identical to PYRB_CYTH3: Aspartate carbamoyltransferase (pyrB) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K00609, aspartate carbamoyltransferase catalytic subunit [EC: 2.1.3.2] (inferred from 85% identity to sli:Slin_0344)

Predicted SEED Role

"Aspartate carbamoyltransferase (EC 2.1.3.2)" in subsystem De Novo Pyrimidine Synthesis (EC 2.1.3.2)

MetaCyc Pathways

superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
UMP biosynthesis II (6/6 steps found)
superpathway of pyrimidine ribonucleotides de novo biosynthesis (8/9 steps found)
UMP biosynthesis I (5/6 steps found)
UMP biosynthesis III (5/6 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YXL4 at UniProt or InterPro

Protein Sequence (307 amino acids)

>CA264_20465 aspartate carbamoyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MQELSVRHLLGIKDITPQDIQLIFETADNFKDVLNRPIKKVPSLRDITIANVFFENSTRT
RLSFELAEKRLSADVINFSSSSSSVKKGETLLDTVNNILAMKVDMIVMRHSSPGAPHFLS
KHIPANIVNAGDGTHEHPTQALLDSFSIRERLGEVAGKKVVIIGDILHSRVALSNIFALQ
KQGAEVMVCGPITLLPKYIKELGVKVETDVRKALAWCDVANVLRIQLERQQMKYFPSLRE
YTLYYGIDKKMLDSLNKEIVLMHPGPINRGVELSSDAADSHHSIILNQVENGVAVRMAVL
YLLAQKG