Protein Info for CA264_20380 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: lytic transglycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 762 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF01464: SLT" amino acids 80 to 176 (97 residues), 41.7 bits, see alignment E=7.7e-15 PF01476: LysM" amino acids 362 to 404 (43 residues), 18.4 bits, see alignment 1.7e-07 amino acids 575 to 616 (42 residues), 42.6 bits, see alignment 4.7e-15 amino acids 651 to 693 (43 residues), 44.8 bits, see alignment 9.7e-16 amino acids 718 to 760 (43 residues), 36.2 bits, see alignment 4.7e-13

Best Hits

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase D precursor (EC 3.2.1.-)" (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YXQ6 at UniProt or InterPro

Protein Sequence (762 amino acids)

>CA264_20380 lytic transglycosylase (Pontibacter actiniarum KMM 6156, DSM 19842)
MRKSFTALLTLLLLPLLVLAQGVTVPKNIYFADIHLNISDGAQAEIQKKVDALHRNQTYF
KIKVDLADAYFPVIERVFKEEGVPDDFKYLALQESGLIGDAISTSNAVGYWQFKREAALD
FNLRMDKVVDERRHIIEASRGAALYFKRSNNYYNNWFNSLLSYYLGYTGAKAYTKASDQG
ARKMEITEKAHPYVITFLAHKVAYDSFIGKASPPAVSLREMRANPGQSLSEIALATKTDY
AELEKYNKWLLGNSIPSDKDYYVMIPVRNGNEGGFLASAKDNNHSLTHQAGTRKASAAMV
KRNNLNALVAREGDTKDKLALQAGISTRRFLKYNDMYSFDKVAPGTAYYIEKKRTSADTE
YHVVQPGETMQMISQHYGVRLGWLLFKNRMKRNEVPVPGRVLWLQKRRPGSTPVEVRDLD
KKSVANTSKQAYEPVAEASAEPKENIFTRFINSLKGNRQETEPQETQPAVERKAAAVTQE
AELVEETALKEVEEETAEAVTAAPAPAAKKTATALYPGTAKAAAQPKPAAEKPFPAGTGA
PAQQKVVAAETFPSTAPPAATPAPAQKQTGTPTTHVVKQGETLYGISRMYAVTVNDLATW
NNLGDTPLKMGQELLVAEPQMQPEPAATAEAVAEDAAEVPATLLSTSSPYHKVAAGETLY
QISKKYNVLLEELRQWNSLADNSIQLGQELRIKAPATTTAAPASEEAAAPAGNSRVYHTV
AGGESMYQISRKYGVTIKDIMEWNNKSDFSVSVGEKLLIKQK