Protein Info for CA264_20360 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: thiol reductase thioredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00085: Thioredoxin
  • amino acids 6 to 104 (99 residues), 114.6 bits, E=3.1e-37
• TIGR01068: thioredoxin
  • amino acids 9 to 105 (97 residues), 132.7 bits, E=2.3e-43
• PF13098: Thioredoxin_2
  • amino acids 19 to 103 (85 residues), 37 bits, E=5.7e-13

Best Hits

Swiss-Prot: 61% identical to THIO2_CHLTE: Thioredoxin 2 (trx2) from Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)

KEGG orthology group: K03671, thioredoxin 1 (inferred from 79% identity to mtt:Ftrac_1536)

MetaCyc: 52% identical to reduced thioredoxin 1 (Escherichia coli K-12 substr. MG1655)
RXN-20161 [EC: 1.8.4.16]

Predicted SEED Role

"Thioredoxin" in subsystem Glycine reductase, sarcosine reductase and betaine reductase

MetaCyc Pathways

• periplasmic disulfide bond reduction (1/2 steps found)
• cytochrome c biogenesis (system I type) (1/11 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.16

Sequence Analysis Tools

See A0A1X9YXJ4 at UniProt or InterPro

Protein Sequence (108 amino acids)

>CA264_20360 thiol reductase thioredoxin (Pontibacter actiniarum KMM 6156, DSM 19842)
MANKAIEITDANFDEIINSDKPVLVDFWAEWCGPCRMVGPIVEELAGEYEGKAVIGKVDV
DANPQTSAKFGIRSIPTLLVFKNGEVVDKQVGAVPKNVLSQKLDSQMA