Protein Info for CA264_20315 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: cystathionine gamma-synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01053: Cys_Met_Meta_PP
  • amino acids 5 to 378 (374 residues), 524.8 bits, E=1.9e-161
• PF00266: Aminotran_5
  • amino acids 43 to 199 (157 residues), 22.3 bits, E=1.2e-08
• PF00155: Aminotran_1_2
  • amino acids 52 to 233 (182 residues), 42.1 bits, E=1.3e-14

Best Hits

Swiss-Prot: 55% identical to METC_COXBU: Cystathionine beta-lyase (metC) from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)

KEGG orthology group: None (inferred from 71% identity to cpi:Cpin_0494)

MetaCyc: 53% identical to cystathionine gamma-lyase (Helicobacter pylori 26695)
Cystathionine gamma-lyase. [EC: 4.4.1.1]

Predicted SEED Role

"Cystathionine gamma-lyase (EC 4.4.1.1)" in subsystem Cysteine Biosynthesis or Glycine and Serine Utilization or Methionine Biosynthesis or Methionine Degradation (EC 4.4.1.1)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (16/17 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (9/10 steps found)
• superpathway of L-isoleucine biosynthesis I (11/13 steps found)
• L-isoleucine biosynthesis I (from threonine) (6/7 steps found)
• D-serine degradation (3/3 steps found)
• L-cysteine degradation II (3/3 steps found)
• L-methionine degradation II (3/3 steps found)
• L-serine degradation (3/3 steps found)
• superpathway of L-cysteine biosynthesis (fungi) (5/6 steps found)
• L-cysteine biosynthesis III (from L-homocysteine) (2/2 steps found)
• superpathway of L-cysteine biosynthesis (mammalian) (4/5 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (11/15 steps found)
• homocysteine and cysteine interconversion (3/4 steps found)
• L-tryptophan degradation II (via pyruvate) (2/3 steps found)
• hydrogen sulfide biosynthesis II (mammalian) (4/6 steps found)
• L-cysteine biosynthesis VI (reverse transsulfuration) (4/7 steps found)
• glycine betaine degradation III (4/7 steps found)
• L-methionine biosynthesis II (3/6 steps found)
• felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
• L-mimosine degradation (4/8 steps found)
• glycine betaine degradation I (4/8 steps found)
• L-threonine degradation I (2/6 steps found)
• superpathway of L-methionine salvage and degradation (9/16 steps found)
• superpathway of L-threonine metabolism (10/18 steps found)
• glutathione-mediated detoxification I (2/8 steps found)
• purine nucleobases degradation II (anaerobic) (13/24 steps found)
• hypoglycin biosynthesis (3/14 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Glycine, serine and threonine metabolism
• Methionine metabolism
• Nitrogen metabolism
• Selenoamino acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.4.1.1

Use Curated BLAST to search for 4.4.1.1

Sequence Analysis Tools

See A0A1X9YXT4 at UniProt or InterPro

Protein Sequence (379 amino acids)

>CA264_20315 cystathionine gamma-synthase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKFGTKAIHAGVEPDPSTGAIMTPIYQTSTYVQRSPGDHKGYEYSRTHNPTRTQLQNALA
ALENGKHGLCFSSGMAAVDAIMKMLKPGDEVISTNDLYGGSYRIFTKIFRNYGLKFHFTN
MQELSNVEGLINENTKMIWVETPTNPLLNILDIKAYADMAKKHNLLLVADNTFATPYLQT
PLDLGADIVMHSLTKYMGGHSDVVMGAVVVKDDGLNQQLAFIQNSCGATPGPQDCFLVLR
GLKTLHLRMERHCQNGRQVAEYLKGHPKVGKVYWPGFEEHPNHEVAQKQMRDFGGMVSFE
LKGDNVDDATRLLENLKLFALAESLGGVESLCGHPATMTHASIPREDRMKAGLSDTLIRL
SVGVEDAEDLIADLEQAIG