Protein Info for CA264_20310 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: TVP38/TMEM64 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 54 to 78 (25 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 137 to 160 (24 residues), see Phobius details amino acids 167 to 186 (20 residues), see Phobius details amino acids 206 to 224 (19 residues), see Phobius details PF09335: SNARE_assoc" amino acids 71 to 187 (117 residues), 57.8 bits, see alignment E=7.9e-20

Best Hits

KEGG orthology group: None (inferred from 32% identity to sli:Slin_5638)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YXA0 at UniProt or InterPro

Protein Sequence (240 amino acids)

>CA264_20310 TVP38/TMEM64 family protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MKSLPYLRSFIRENASTFVSMLLLVVVPVVVSSTAAVVLYNYQGLLQGLSVWEMLLYFAV
ISVTMALALTPTTFVALVSGFYLGWSGFAGIVVSYGIAALIGYSIAQFVDHGKMMSFLNR
FDKARALMQELRSESWSLIFLTRISPVLPFALMNFVLSLLQIDKRKFFLASIVGMLPRTV
FFFWVGTQARDVVQALQNPDSGRSGQILMVALIVISIGGLYFLFDKALKRSLRKAAAKNE