Protein Info for CA264_20220 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: phosphatase PAP2 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 transmembrane" amino acids 42 to 64 (23 residues), see Phobius details amino acids 99 to 125 (27 residues), see Phobius details amino acids 132 to 153 (22 residues), see Phobius details amino acids 173 to 191 (19 residues), see Phobius details amino acids 203 to 221 (19 residues), see Phobius details amino acids 233 to 252 (20 residues), see Phobius details PF14378: PAP2_3" amino acids 87 to 238 (152 residues), 28.2 bits, see alignment E=1.6e-10 PF01569: PAP2" amino acids 133 to 246 (114 residues), 71.8 bits, see alignment E=4.9e-24

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YXT8 at UniProt or InterPro

Protein Sequence (261 amino acids)

>CA264_20220 phosphatase PAP2 family protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MFKKPFTLISSQVDKLFELPMIKELERKHPKFVGFLHDRLGVQGFFGLPFTTLLIAVFVN
FAVLSELSEHIVNSPGMKAVDTSVTMFFFNLRTDLLSSAIYYFTQLGSVYGVGFTFVTAM
GVLLLKGKWHHGVALLVSVLGSGISIYFTKAYFHRERPMDVGYYDLSSFSFPSGHAAGSV
ALVGMLCILIYQERDQIKAASAWLWLGLLYILLIGFSRIYLGVHFLTDVAGGYLLGSLWV
MVALSLLEFLLLHQRRNRHSV