Protein Info for CA264_20190 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: dolichol-phosphate mannosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 PF00535: Glycos_transf_2" amino acids 6 to 136 (131 residues), 82.4 bits, see alignment E=1.9e-27

Best Hits

KEGG orthology group: None (inferred from 58% identity to ade:Adeh_3358)

Predicted SEED Role

"Polymyxin resistance protein ArnC, glycosyl transferase (EC 2.4.-.-)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) (EC 2.4.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.-.-

Use Curated BLAST to search for 2.4.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YXF1 at UniProt or InterPro

Protein Sequence (247 amino acids)

>CA264_20190 dolichol-phosphate mannosyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MREELTIIVPVYNEEGCLARLCEAMDAFLRQSPMPTQVLFVNDGSTDSSLPQIREICSSR
PGYSFISLDRNRGLSTAIKAGIDHIQSSYIGYIDSDLQTSPLDFLLFFEFLPEYQMVNGI
RARRKDTFVKKMSSKIANGFRRYMINDGIVDTGCPLKIMDAAYAKRVPFFDGMHRFLPAL
IQLQGGKVKQLPVQHFERFAGYSKYHLFNRLWGPLNDTFAFRWMRKRYIRYQIAEEFENQ
PVTNGRI