Protein Info for CA264_20180 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: phospholipid carrier-dependent glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 544 transmembrane" amino acids 7 to 31 (25 residues), see Phobius details amino acids 69 to 85 (17 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 117 to 136 (20 residues), see Phobius details amino acids 167 to 195 (29 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details amino acids 261 to 281 (21 residues), see Phobius details amino acids 293 to 310 (18 residues), see Phobius details amino acids 316 to 334 (19 residues), see Phobius details amino acids 346 to 366 (21 residues), see Phobius details amino acids 372 to 391 (20 residues), see Phobius details amino acids 400 to 421 (22 residues), see Phobius details PF02366: PMT" amino acids 12 to 239 (228 residues), 66.1 bits, see alignment E=3.6e-22 PF13231: PMT_2" amino acids 66 to 221 (156 residues), 65 bits, see alignment E=1.1e-21

Best Hits

Predicted SEED Role

"Polymyxin resistance protein ArnT, undecaprenyl phosphate-alpha-L-Ara4N transferase; Melittin resistance protein PqaB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YX85 at UniProt or InterPro

Protein Sequence (544 amino acids)

>CA264_20180 phospholipid carrier-dependent glycosyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MLKDEGLYSTSAALVLLLVFLTVLLYNLGGWGVLETSEARYAEISRELLLSKDWLHPRLL
GIQHFHKPPLTYMISAAGMALFGIGEFGARFFLQVSLVLQAFLVYQIALELYKEKRMAFT
AMVIYITIPAVLLSARNLTTDSFLTTFELLAIWAWIRYTVVPKAGWLYLFYTSLALAFLT
KGPVGLIFPLLLVVGYRAKGHFTSRSNIPHHVASLLLFFILGASWYGYLMWQDQRFVDYF
LFKHTVQRYANPATFGRSQPWWFYLVLAPALSLPWSAVALLNLRRLKTLPGQLRRLFICW
LLVPLLFFSLSGSKLILYILPLFSGLALLVTWVLHTLPSPAVRRVLIASFAYFGVLAVVL
TLAPLLPFGLNIPVWVLAFPLLTLGSLFMIWRRRRIGELTWLLFMPLIFTVFLVLYATHL
MGANPDLVNSTANLAGVLREERMQGKTVVVYDQLLPSLAFALNRSLITIHDDSKSLERET
QFEADEAWRDNLLQLSRPEDLARLPRILNGNTVLVVKGDLPAEKLWLKGSFEHSVKVGKW
VLYY