Protein Info for CA264_20175 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 561 transmembrane" amino acids 23 to 41 (19 residues), see Phobius details amino acids 101 to 121 (21 residues), see Phobius details amino acids 130 to 148 (19 residues), see Phobius details amino acids 154 to 170 (17 residues), see Phobius details amino acids 179 to 196 (18 residues), see Phobius details amino acids 202 to 218 (17 residues), see Phobius details amino acids 229 to 250 (22 residues), see Phobius details amino acids 275 to 298 (24 residues), see Phobius details amino acids 308 to 329 (22 residues), see Phobius details amino acids 335 to 355 (21 residues), see Phobius details amino acids 371 to 393 (23 residues), see Phobius details amino acids 400 to 422 (23 residues), see Phobius details amino acids 429 to 449 (21 residues), see Phobius details PF02366: PMT" amino acids 57 to 248 (192 residues), 41.8 bits, see alignment E=9.8e-15 PF13231: PMT_2" amino acids 79 to 240 (162 residues), 60.6 bits, see alignment E=2.4e-20

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YXB4 at UniProt or InterPro

Protein Sequence (561 amino acids)

>CA264_20175 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MALQVKFSISNLAVGRRWFQHTHTQLLLLFLLVGLTYFPQLGKQGPSLMEARNFISAREM
VEDGNWLVPTLNGEVRLAKPPLPTWLTAVSGMAAGDIGNLVALRFPAAVMSALMVFFLYF
LGRQLTRDKLTPFLAAAVLASSFGLFNIGREGSWDVYCHSFMLGALWLLVKGLRKEGDSY
SMFALCGLLMGCSFLSKGPVAFYAMLLPFLVSYLYCFGRSGFWVKRKRLVLTFGVALLLS
LAWPVFIFMVEPEALARNVSNESAAWVNRHVKPFWYYWGFWSQTGAWALFTLAAMSVSYA
RKRINRYVGSYTFIFVWLVVAVLLLSVIPEKKERYLLPAIVPMALLTGGYVRYLLSGVWR
SVNDNWAKRLLLFNTGLMLVAAIGFPVAAYLLAYQTGIISLSYQLCLTVSSLILALSLLI
ALLKQTATLAIVTVLLLNSLVLVSGFPLYEKVRHPVGSYRSLVHVRHEKEVSSYPFYAVD
GLPIVHLWEVGKQVDTLRIQNQRLQLPNELPAVVFSPVTLTQAHMADTTVFVNKVNTYHV
SRNNPEEVYHIYVLSVKKPLN