Protein Info for CA264_20120 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 137 TIGR04191: putative bacilliredoxin, YphP/YqiW family" amino acids 2 to 137 (136 residues), 190.6 bits, see alignment E=6.4e-61 PF06491: Disulph_isomer" amino acids 2 to 137 (136 residues), 200 bits, see alignment E=8.2e-64

Best Hits

Swiss-Prot: 53% identical to Y972_CYTH3: UPF0403 protein CHU_0972 (CHU_0972) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: None (inferred from 66% identity to shg:Sph21_1234)

Predicted SEED Role

"FIG01094268: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YYS8 at UniProt or InterPro

Protein Sequence (137 amino acids)

>CA264_20120 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MYPEYMVAPIREDLTSAGFEQLMTPEEVEQAVKTNGTVLLAVNSVCGCAASKARPALKMA
VAAADKKPSKLVTVFAGMEQDAVAKAREHMLPYPPSSPSIALFKDGELVHMIERYHIEGN
ELHRIVDNLKGAFEAYC