Protein Info for CA264_20115 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: phosphoribosylamine--glycine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 PF02844: GARS_N" amino acids 1 to 104 (104 residues), 120.6 bits, see alignment E=1.1e-38 TIGR00877: phosphoribosylamine--glycine ligase" amino acids 1 to 423 (423 residues), 493.5 bits, see alignment E=2.4e-152 PF01071: GARS_A" amino acids 105 to 299 (195 residues), 249.4 bits, see alignment E=6.5e-78 PF02786: CPSase_L_D2" amino acids 109 to 212 (104 residues), 30.5 bits, see alignment E=6.6e-11 PF02655: ATP-grasp_3" amino acids 113 to 294 (182 residues), 26.5 bits, see alignment E=1.5e-09 PF02843: GARS_C" amino acids 334 to 422 (89 residues), 106.7 bits, see alignment E=1.5e-34

Best Hits

Swiss-Prot: 47% identical to PUR2_RALSO: Phosphoribosylamine--glycine ligase (purD) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: None (inferred from 59% identity to lan:Lacal_1052)

Predicted SEED Role

"Phosphoribosylamine--glycine ligase (EC 6.3.4.13)" in subsystem De Novo Purine Biosynthesis (EC 6.3.4.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YXA2 at UniProt or InterPro

Protein Sequence (429 amino acids)

>CA264_20115 phosphoribosylamine--glycine ligase (Pontibacter actiniarum KMM 6156, DSM 19842)
MNVLVIGSGGREHAIAWKLSQSEFCDKVFVAPGNAGTAKFGTTAAVDIHDFEELGKFAAD
FNIMMVVVGPENSLVEGIHDYFQSSEYLKHILVIGPKKAGAMLEGSKDFCKAFLQRHNIP
TARYKTFTEATFKDAVEYLKTQSYPTVIKADGLAAGKGVIIAQDYEEAFDALDAMLRNKR
FGNASSKVVIEEYLQGIELSVFILTDGKDYVLLPEAKDYKRIGEGDTGLNTGGMGAISPV
PFASEAFMQKVKERVIEPTLRGMQADQLDYTGFLFIGLMNVNGDPYVIEYNVRLGDPETE
AILPRIKSDLFMLFKALHEHKLGEFELEIDPRTATTVILASGGYPEGYEKGKEISGLENV
PEGVLVFHAGTKQLNGKLLNTGGRVFAVTALGDTMEQALEKANAAAEAITWQDRYYRRDI
GFDLRKLSV