Protein Info for CA264_20105 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: D-arabinose 5-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 PF01380: SIS" amino acids 44 to 171 (128 residues), 93.3 bits, see alignment E=1.1e-30 TIGR00393: sugar isomerase, KpsF/GutQ family" amino acids 45 to 312 (268 residues), 318.1 bits, see alignment E=2.6e-99 PF00571: CBS" amino acids 201 to 257 (57 residues), 32.1 bits, see alignment E=1.2e-11 amino acids 269 to 320 (52 residues), 40 bits, see alignment 4.2e-14

Best Hits

Swiss-Prot: 45% identical to KDSD_SHIFL: Arabinose 5-phosphate isomerase KdsD (kdsD) from Shigella flexneri

KEGG orthology group: K06041, arabinose-5-phosphate isomerase [EC: 5.3.1.13] (inferred from 65% identity to chu:CHU_0298)

MetaCyc: 45% identical to D-arabinose 5-phosphate isomerase KdsD (Escherichia coli K-12 substr. MG1655)
Arabinose-5-phosphate isomerase. [EC: 5.3.1.13]

Predicted SEED Role

"Arabinose 5-phosphate isomerase (EC 5.3.1.13)" in subsystem KDO2-Lipid A biosynthesis (EC 5.3.1.13)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YXK8 at UniProt or InterPro

Protein Sequence (323 amino acids)

>CA264_20105 D-arabinose 5-phosphate isomerase (Pontibacter actiniarum KMM 6156, DSM 19842)
MNLPNNIALTAKKVLNAEAEAIARLADFIDEEFENCVKAILQLKGRVVVTGIGKSANIAQ
KIVATLNSTGTPALFMHAADAIHGDLGMIQPDDFVICISKSGNTPEIKVLVPLLKRKGSK
LAALVCSTDSYLAQSADFVLNANVEREACPHNLAPTTSTTASLALGDALAVSLLEARGFS
SSDFATLHPGGSLGKRLYLKVEDIYTQNEAPSVKEDATLKEIIIEISSKRLGATAVVKKD
SEELVGIITDGDLRRMLNKYEAIQAITATDIMTPAPLTVEPDCYAAEAMAIMQDKSITQL
IVTKSGKFEGFVHLHDLLKEGLV