Protein Info for CA264_20055 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: peptidase M41

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 707 transmembrane" amino acids 27 to 44 (18 residues), see Phobius details amino acids 148 to 168 (21 residues), see Phobius details PF06480: FtsH_ext" amino acids 28 to 130 (103 residues), 32.7 bits, see alignment E=1.5e-11 TIGR01241: ATP-dependent metallopeptidase HflB" amino acids 148 to 637 (490 residues), 732.8 bits, see alignment E=1e-224 PF00004: AAA" amino acids 239 to 370 (132 residues), 154.8 bits, see alignment E=3.5e-49 PF17862: AAA_lid_3" amino acids 394 to 437 (44 residues), 55.1 bits, see alignment 8.5e-19 PF01434: Peptidase_M41" amino acids 453 to 636 (184 residues), 223.3 bits, see alignment E=5e-70

Best Hits

KEGG orthology group: K03798, cell division protease FtsH [EC: 3.4.24.-] (inferred from 70% identity to mtt:Ftrac_1834)

Predicted SEED Role

"Cell division protein FtsH (EC 3.4.24.-)" in subsystem Bacterial Cell Division (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YXR1 at UniProt or InterPro

Protein Sequence (707 amino acids)

>CA264_20055 peptidase M41 (Pontibacter actiniarum KMM 6156, DSM 19842)
MAEKNNKGNNRKKKPIIPNTPPRPTMQLWMLAVLILLIFGLTYLNKSNSSIETTQQDFEE
MLLSGDVKKLTLVNGKTVEVYLEKEALQNEKYKAELNDRGVLTMEEGPHYHFQVISAESF
KEDLDKLQAELPREEQVPLKPEQRTGFADFFFQWGFLILLLFGFWFLMRRVTSGGTGGQI
FNIGKSKAALFDAENKVKITFKDVAGLEEAKEEVQEIVEFLKNPSKFTILGGKIPKGALL
VGPPGTGKTLLAKAVAGEADVPFFSLSGSDFVEMFVGVGAARVRDLFKQAKAKAPCIIFI
DEIDAIGRHRSRGATPGGNDERENTLNSLLVEMDGFATDSGVIILAATNRPDTLDSALLR
PGRFDRQVSIDKPDINGRTEIFAVHLKPLTLAADVDARKLAAQTPGFAGAEIANVCNEAA
LIAARRNKKAVDQQDFNDAVDRVIGGLEKKNKIISPEEKKIVAYHEAGHAIAGWFLEHAD
PLVKVSIVPRGVAALGYAQYLPKEQFLYTTEQLIDEMCMALGGRAAEELVFGKISTGALS
DLERITKMAYSIVTMYGMNDKIGNVSFYDSKQTDMAFNKPYSEATAETIDQEVRKIIDAA
YQRTKDLLRAKGRELEIVSQELLQKEILFQSDLERLVGPRPFDALTTYQAHTSGTDRSQT
KSEVEQTHPVEVGQTKHPEQEEGNVPGTPLGNGSTPAEQDNVNSRTA