Protein Info for CA264_20020 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 42 to 64 (23 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details amino acids 147 to 169 (23 residues), see Phobius details amino acids 175 to 196 (22 residues), see Phobius details amino acids 216 to 232 (17 residues), see Phobius details amino acids 252 to 278 (27 residues), see Phobius details amino acids 299 to 316 (18 residues), see Phobius details amino acids 331 to 353 (23 residues), see Phobius details amino acids 365 to 386 (22 residues), see Phobius details amino acids 392 to 410 (19 residues), see Phobius details amino acids 422 to 440 (19 residues), see Phobius details amino acids 446 to 466 (21 residues), see Phobius details

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YXD4 at UniProt or InterPro

Protein Sequence (474 amino acids)

>CA264_20020 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MLRKLLSHAALYGLAAQVPRVAGVLALPIITPYLTTTDYGVAGVVTAYVGALGLFQSLGL
SVVMGNTFTRHPTRFKWVWRQLHGFILLWSALYSVPLVGLLYAVIPDEAEANRWELILLN
LVPVVLLSNTSFFGNFLYHMRQRPLPVAAYSFITGGVTVALNIYFIAFLRLGYMGWFYAT
FLASVAGFVLLFYPVYVQEGLWPIFKFKLYRIRSSLKVSLPLLPHHFSFFLLDASDKLML
DALRVPLPRIGFYNIASSFGLYFSAASNAVVEAATPFYMRYFSKEGDPESLLEARRMTFS
LQVLFLGATALGSLWMKEVFELLIRNETLQGAYPLAIIMLMGYTYRPMYLAVVNRLSFQE
KTKELWKISLVAGVGNVLLNLLLIPVFGIEAAAFTTFAALVYLGYSGFLLKEYRALSNVP
YYPWRWLALTIVLLLAVYALADAGPLLKALISLLILAFAGSGLWRLNKAKAGAL