Protein Info for CA264_19955 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 PF00891: Methyltransf_2" amino acids 27 to 156 (130 residues), 27.3 bits, see alignment E=7.6e-10 PF01209: Ubie_methyltran" amino acids 41 to 155 (115 residues), 33.1 bits, see alignment E=1.3e-11 PF13489: Methyltransf_23" amino acids 46 to 201 (156 residues), 50.2 bits, see alignment E=8.8e-17 PF13847: Methyltransf_31" amino acids 46 to 153 (108 residues), 56 bits, see alignment E=1.4e-18 PF08241: Methyltransf_11" amino acids 49 to 149 (101 residues), 70.3 bits, see alignment E=6.5e-23 PF08242: Methyltransf_12" amino acids 49 to 146 (98 residues), 61.4 bits, see alignment E=3.9e-20 PF13649: Methyltransf_25" amino acids 49 to 145 (97 residues), 61.9 bits, see alignment E=2.8e-20

Best Hits

KEGG orthology group: None (inferred from 60% identity to sml:Smlt0786)

Predicted SEED Role

"Methyltransferase (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YX58 at UniProt or InterPro

Protein Sequence (279 amino acids)

>CA264_19955 SAM-dependent methyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MVAVSNEQPEEKYLHGYSPEEQNRLYKQARFMENKIYSDIDFSTVTKLLEVGCGVGAQSE
ILLRRFPHLFLTGVDYSEKQIAQARKYLSTVLYAKDRYELLQENAMDMSFTSQADFDGAF
LCWVLEHIPEPARVLSEVRRVLKPGSPIVITEVLNSSFFVEPYSPNVLQYWMRFNDLQYD
LSGDLFVGAKLGNLLQSVGFQRITTETKTYHLDNRNPAKRAEMIGFWTELLLSGLPQLLE
AGYVDADLAEKVKEEMRAVAKSPNAVFFYTFIQAKAFTS