Protein Info for CA264_19935 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: sodium:calcium symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 42 to 61 (20 residues), see Phobius details amino acids 89 to 110 (22 residues), see Phobius details amino acids 152 to 171 (20 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 235 to 259 (25 residues), see Phobius details amino acids 280 to 300 (21 residues), see Phobius details amino acids 329 to 353 (25 residues), see Phobius details amino acids 372 to 395 (24 residues), see Phobius details amino acids 401 to 423 (23 residues), see Phobius details amino acids 443 to 465 (23 residues), see Phobius details amino acids 521 to 541 (21 residues), see Phobius details PF00209: SNF" amino acids 6 to 125 (120 residues), 78.3 bits, see alignment E=2.7e-26 amino acids 154 to 468 (315 residues), 109 bits, see alignment E=1.3e-35

Best Hits

KEGG orthology group: None (inferred from 70% identity to hhy:Halhy_2313)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YXI0 at UniProt or InterPro

Protein Sequence (550 amino acids)

>CA264_19935 sodium:calcium symporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MSANKESWGSRVGLILAMAGNAVGLGNFLRFPVQAVQNGGGAFIIPYLVCFLVMGIPLLW
IEWSMGRFGGKFGHHSTPFIVDTMHKNRLWKYIGVFGIWTNIAVASYYCYLESWTLSYVM
HSLAGTFADLDQDGVAAFFNEYVSIGKSTLGIPFEPVVFFVLCLLLNTWILSQGLAKGVE
RVAKVGMPMLIVFGAFLAYKGFTVSAGENGAINDSAVGLNFLWTPNYEQLWSPTVWLAAA
GQIFFTLSVGMGTVHCYASYVRSKDDIALNAMSAGWMNEFVEVVLGSSILIPISIGYLGI
DRVTELVQLGGLGLGFKTLPYLFFQWGDVIGAVAGFMWFGLLFFAGITSSLAMGTPWIGF
LQDEFNWKRKSAAWSFGLIVLILGMPTVLFFKYGVFDEYDYWAGTVSLVVFALFETILFA
WVFGMNKGWREITSGADIKVPGIYRFIIKFITPLLLLWVFVGSLVTPKGGDWGKAFAGEW
VLDDGSIINKLKNVSLKRQLAEATDPAVIQQLQDTLFFVNASRILLVTVFLSIALLVYIA
YKKRVREGRI