Protein Info for CA264_19885 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: uridine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00485: PRK
  • amino acids 6 to 185 (180 residues), 133.8 bits, E=3.6e-43

Best Hits

Swiss-Prot: 35% identical to URK_BREBN: Uridine kinase (udk) from Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)

KEGG orthology group: K00876, uridine kinase [EC: 2.7.1.48] (inferred from 67% identity to mtt:Ftrac_2535)

Predicted SEED Role

"Uridine kinase (EC 2.7.1.48)" (EC 2.7.1.48)

MetaCyc Pathways

• superpathway of pyrimidine ribonucleosides salvage (9/10 steps found)
• pyrimidine ribonucleosides salvage I (3/3 steps found)
• nucleoside and nucleotide degradation (archaea) (4/10 steps found)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.48

Sequence Analysis Tools

See A0A1X9YXG5 at UniProt or InterPro

Protein Sequence (206 amino acids)

>CA264_19885 uridine kinase (Pontibacter actiniarum KMM 6156, DSM 19842)
MQKPFIVGITGGSASGKTTFLNKLLTSFSPENICLISQDNYYKPREHQTKDLNGIVNFDL
PSCIDDEAYAHDILKVSQGETVYRTEYTFNNPNVVPKQLEFRPAPIVVVEGIFVFYFEEI
ANLLDLKVYIDAKEYIKLQRRIVRDKVERGYDLDDVLYRYTNHVAPTYEKYIKPYKNDAD
IIIPNNANFERGLEVLTTYLNARIKA