Protein Info for CA264_19835 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: chorismate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01264: Chorismate_synt
  • amino acids 9 to 352 (344 residues), 491.1 bits, E=5.7e-152
• TIGR00033: chorismate synthase
  • amino acids 9 to 357 (349 residues), 495 bits, E=5.3e-153

Best Hits

Swiss-Prot: 71% identical to AROC_CYTH3: Chorismate synthase (aroC) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K01736, chorismate synthase [EC: 4.2.3.5] (inferred from 71% identity to chu:CHU_0369)

Predicted SEED Role

"Chorismate synthase (EC 4.2.3.5)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 4.2.3.5)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (17/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• chorismate biosynthesis I (7/7 steps found)
• superpathway of L-tyrosine biosynthesis (9/10 steps found)
• chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)
• superpathway of chorismate metabolism (39/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.3.5

Sequence Analysis Tools

See A0A1X9YXF5 at UniProt or InterPro

Protein Sequence (359 amino acids)

>CA264_19835 chorismate synthase (Pontibacter actiniarum KMM 6156, DSM 19842)
MSNSYGSVFRITTFGESHGAAVGVIVDGCPAGLEITTEEIQQALDRRRPGQSDITTPRKE
EDKVTILSGMFEGKTTGTPIAMVVNNKDQHSHDYSHIAQAFRPSHADYTYTTKYGLRDYR
GGGRSSARETVARVAAGALAAKLLQHHGITVQAYVSQVGPVKLRKPYHKLDLSQIDSNKV
RCPDGKIAARMIGVVEEARDNLDTIGGVVSCVIKGVPAGLGEPVFDKLHAELGKAMLSIN
AVKGFEYGSGFEGVKLNGSQHNDQFYTDDEGNVRTRTNNSGGIQGGISNGQDIYFNVAFK
PVATILQPQTTINDAGEEITLQGKGRHDPCVLPRAVPIVDAMAALVIADFLLRQRVNKL