Protein Info for CA264_19790 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 PF02771: Acyl-CoA_dh_N" amino acids 19 to 131 (113 residues), 141.2 bits, see alignment E=3.4e-45 PF02770: Acyl-CoA_dh_M" amino acids 135 to 226 (92 residues), 74.5 bits, see alignment E=1.2e-24 PF00441: Acyl-CoA_dh_1" amino acids 239 to 383 (145 residues), 117.7 bits, see alignment E=1.1e-37 PF08028: Acyl-CoA_dh_2" amino acids 253 to 372 (120 residues), 42.4 bits, see alignment E=1.7e-14

Best Hits

Swiss-Prot: 52% identical to GCDH_PIG: Glutaryl-CoA dehydrogenase, mitochondrial (Fragment) (GCDH) from Sus scrofa

KEGG orthology group: K00252, glutaryl-CoA dehydrogenase [EC: 1.3.99.7] (inferred from 82% identity to mtt:Ftrac_1182)

MetaCyc: 57% identical to glutaryl-CoA dehydrogenase (Pseudomonas putida KT2440)
GLUTARYL-COA-DEHYDROGENASE-RXN [EC: 1.3.8.6]

Predicted SEED Role

"Glutaryl-CoA dehydrogenase (EC 1.3.99.7)" (EC 1.3.99.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.8.6 or 1.3.99.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YX20 at UniProt or InterPro

Protein Sequence (392 amino acids)

>CA264_19790 acyl-CoA dehydrogenase (Pontibacter actiniarum KMM 6156, DSM 19842)
MAYESSGAPDYYNIDDLLTEEHLLIRQTMRDFVKREISPNIEQWAQDAHFPSEIVKKFGD
VGAFGPTIPTEYGGGGLDYISYGIIMQEIERGDSGMRSTASVQGSLVMYPIYKYGSEEQR
KKYLPKLASGEWLGCFGLTEPDHGSNPGGMVTNIKDMGDHYLLNGAKMWISNSPECQVAV
VWAKNEEGRIKGLIVERGMEGFSTPEIHNKWSLRASCTGELVFDNVKVPKENLLPNVEGL
RGPLGCLDSARYGISWGAIGAAIDCYESARKYSMERIQFDKPIGAFQLTQKKLAEMLTEI
TKAQLLAWRLGSLMNEGKATTQQISMAKRNNVDMALHIAREARQIHGGMGITGEYPIMRH
MMNLESVITYEGTHDIHLLITGADITGISAFK