Protein Info for CA264_19785 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: TonB-dependent receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 810 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF13620: CarboxypepD_reg" amino acids 23 to 97 (75 residues), 64.3 bits, see alignment E=2.8e-21 PF13715: CarbopepD_reg_2" amino acids 23 to 108 (86 residues), 75.1 bits, see alignment E=8.8e-25 PF08308: PEGA" amino acids 60 to 97 (38 residues), 21.8 bits, see alignment 3.6e-08 PF07715: Plug" amino acids 116 to 223 (108 residues), 45.8 bits, see alignment E=2e-15 PF00593: TonB_dep_Rec" amino acids 315 to 766 (452 residues), 82.7 bits, see alignment E=1.3e-26

Best Hits

Predicted SEED Role

"Thiamin-regulated outer membrane receptor Omr1" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YX48 at UniProt or InterPro

Protein Sequence (810 amino acids)

>CA264_19785 TonB-dependent receptor (Pontibacter actiniarum KMM 6156, DSM 19842)
MKIVLIALAVMLLPLQLLAQFKLSGRVSDVAKGDALAGASVVLERTGTGVATGPSGYYEF
QSLPAGDYTLKVSYLGYEPEVRQVTLQQDERVDFTLRQQALQTGEVVVSATRANAKTGTT
FTNVSKAEIAERNFGQDLPYLLEQTPSVVVNSDAGAGVGYTGIRIRGSDITRINVTVNGI
PINDAESHGAFFVNMPDLASSIQDIQVQRGVGTSTNGAGAFGASLNVRTIGVNREAYAEA
VNGYGSFDTWRHSVSFGSGLINDRFTVDGRLSKVSSDGYIDRAFSDLKSYYLSAGYHGKT
GMLKFVTFSGKEKTYQAWDGVPEDKLETDRTYNGLTYENETDNYQQDHYQLHYSKDLLPR
LNLGGAFHFTRGRGYYEQYKYDQKLSKYGISPVVLGDTSIKRSDLIRQKWLDNYFYGATY
ALNYFTENGKLNATLGGAWNKYDGDHYGEVIWARFASDSELGQRYYFNNAVKTDFNIFGK
ANYQLTERLGVFGDLQYRTINYEIEGEDDDRRDVTQQVDFQFLNPKAGITYEVAGGQTVY
ASYAVGHREPVRSDFTDQTLADQQNGVRPEAEALYNLEVGYRLRGTSPAILGQRARYTLD
ANFYHMDYDNQLVQTGQLNDVGSPLRTNIKDSYRAGVELAAMLNLGELVELSSNVTFSRN
KVKNYTDYLYVYDADYNVEDIVETNYSETDISFSPAVVSAHKLEVQPLRGFKAAFLYKTV
SEQYLDNTGSAARKLDGYQVADLRLRYTLRPSFLKELEVALLVSNLFNAEYEANGYTFSE
RYAGDATRYDYNYYYPQATRNYMLTVGVKF