Protein Info for CA264_19760 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 37 to 56 (20 residues), see Phobius details amino acids 62 to 80 (19 residues), see Phobius details amino acids 90 to 106 (17 residues), see Phobius details amino acids 128 to 148 (21 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details amino acids 182 to 198 (17 residues), see Phobius details amino acids 204 to 222 (19 residues), see Phobius details PF04973: NMN_transporter" amino acids 40 to 224 (185 residues), 167.2 bits, see alignment E=1.9e-53 TIGR01528: nicotinamide mononucleotide transporter PnuC" amino acids 40 to 225 (186 residues), 91.7 bits, see alignment E=2.7e-30

Best Hits

Predicted SEED Role

"Ribosyl nicotinamide transporter, PnuC-like" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation or PnuC-like transporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YX01 at UniProt or InterPro

Protein Sequence (237 amino acids)

>CA264_19760 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MEVWQSLHVGLPAEALLLAAVNGSAAQLWQQFLVGMQQTSLLEYIAVVAGIVSVWYSRKE
HILVFPIGLISTVIYVYLSFKHHLIGEASVNVYYSVLSVYGWVLWARKNQQEEYVLHISF
SSRKQWGQQLAFFAVLYAVIFFALSYLKSAFYDGVIPWADAFASATAYTGMWLMAKKKVE
SWYWWIATNVASVPLYFVKGLVFTSVFYVVLLAMAFAGLVEWKRKVELRKARVSEPA