Protein Info for CA264_19750 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: IMP dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00478: IMPDH
  • amino acids 12 to 476 (465 residues), 543.5 bits, E=3.9e-167
• TIGR01302: inosine-5'-monophosphate dehydrogenase
  • amino acids 12 to 457 (446 residues), 626.2 bits, E=1.7e-192
• PF00571: CBS
  • amino acids 97 to 144 (48 residues), 50.8 bits, 3.5e-17
  • amino acids 153 to 207 (55 residues), 46.8 bits, 6.3e-16
• PF03060: NMO
  • amino acids 215 to 375 (161 residues), 33.9 bits, E=4.9e-12
• PF01070: FMN_dh
  • amino acids 274 to 366 (93 residues), 25.1 bits, E=1.8e-09

Best Hits

Swiss-Prot: 65% identical to IMDH_AQUAE: Inosine-5'-monophosphate dehydrogenase (guaB) from Aquifex aeolicus (strain VF5)

KEGG orthology group: K00088, IMP dehydrogenase [EC: 1.1.1.205] (inferred from 75% identity to sli:Slin_1193)

MetaCyc: 44% identical to inosine-5'-monophosphate dehydrogenase 1 monomer (Homo sapiens)
IMP dehydrogenase. [EC: 1.1.1.205]

Predicted SEED Role

"Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205)" in subsystem Purine conversions (EC 1.1.1.205)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• purine nucleotides degradation II (aerobic) (10/11 steps found)
• superpathway of purine nucleotide salvage (12/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• inosine 5'-phosphate degradation (4/4 steps found)
• ureide biosynthesis (5/7 steps found)
• adenosine nucleotides degradation I (5/8 steps found)
• purine nucleotides degradation I (plants) (7/12 steps found)
• superpathway of purines degradation in plants (8/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.205

Use Curated BLAST to search for 1.1.1.205

Sequence Analysis Tools

See A0A1X9YX78 at UniProt or InterPro

Protein Sequence (489 amino acids)

>CA264_19750 IMP dehydrogenase (Pontibacter actiniarum KMM 6156, DSM 19842)
MLSDQSKILFEALTYDDVLLLPAYSEVLPHQTDTSSQLTRNIRINIPLVSAAMDTVTEAD
LAIAMAQEGGIGIIHKNMSIKKQAGQVRKVKRSESGMILDPITLNENATLGDAVQIMTEN
KIGGIPIVNDEGRLTGIITNRDLRFQKDLTQPVSAIMTSQNLITAQKGTDLAKAEDILQE
YKIEKLPVVDENGKLAGLITYKDILKKKDRPFACKDEFGRLRVGAAVGVTPDVLDRVKAL
VEAGVDVISVDTAHGHSKGVLDAVRRIKDTFPDVDLIAGNVATAEGAKALADAGADAVKV
GVGPGSICTTRVIAGIGVPQLSAVMEAARGLEGTGVPVIADGGIKFSGDVVKALAGGAST
VMIGSLLAGTEEAPGEMLIYEGRKYKTYRGMGSVEAMEEGSKDRYFQGDEKDSKKLVPEG
IVGRVAYKGLVNEVIYQLAGGLRAGMGYCGTPTINALWDAKMVKISGAGLRESHPHDVQI
MREAPNYSR