Protein Info for CA264_19625 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: DNA mismatch repair protein MutS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 604 transmembrane" amino acids 30 to 49 (20 residues), see Phobius details amino acids 55 to 74 (20 residues), see Phobius details amino acids 214 to 234 (21 residues), see Phobius details amino acids 240 to 257 (18 residues), see Phobius details amino acids 324 to 346 (23 residues), see Phobius details amino acids 447 to 455 (9 residues), see Phobius details PF00488: MutS_V" amino acids 426 to 586 (161 residues), 87.7 bits, see alignment E=5.1e-29

Best Hits

Predicted SEED Role

"MutS-related protein, family 1" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YWZ1 at UniProt or InterPro

Protein Sequence (604 amino acids)

>CA264_19625 DNA mismatch repair protein MutS (Pontibacter actiniarum KMM 6156, DSM 19842)
MSESRENLYLGRASRFAEQEKKAAAKSGAVSWLRVAVFIAGAGLAYYFFSTDSNTAGAAA
ILFFYLVFILVMRWHSRLDFTYQQLRLLRLVNEQEVERLQGKLGRFDSGQEFVDDHHPYS
SDLDIFGQNSLFQLLNRSVTSVGKEKLASWLRQAAAPQEVLQRQQAAAELSADDRLDWLQ
EALALPMHYKHDEASAATFINWFSGKAFFRQHAWLRPLILILPVLTLAAIAAWLYGMSGW
IPVAFLLVQFLLAYRFRVERDEYYENSIGIYEAIRSYTKQLQHIEKQSFTAPKLQALQQQ
LSASGTKASVSINKLASIIDFFSWRLSTLMAFFLNTVLMWDFVWMYRLESWKGQHLQQLE
HSLDVLSEFEALTSIAAFQHAHPQYAVPQLSQVPFFYQATALAHPLIFSVRPVSNDFEMQ
GAGHTIVITGSNMSGKTTFLRTVGINMVLALMGAPACARSITVAPAQVYTAMRTADNLAE
NTSSFYAELKRLRVLLELTEQGQPVFYLLDEILKGTNSRDRHLGAMSLIRQLHKRNAAGL
ISTHDLELGAMEQELPGSVKNFSFNSDIIGNEINFDYKLTPGLCRSFNASKLMQLMGIEI
EEEA