Protein Info for CA264_19450 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: type I methionyl aminopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 TIGR00500: methionine aminopeptidase, type I" amino acids 5 to 247 (243 residues), 307.3 bits, see alignment E=4e-96 PF00557: Peptidase_M24" amino acids 11 to 238 (228 residues), 165.6 bits, see alignment E=7.1e-53

Best Hits

Swiss-Prot: 54% identical to MAP1_CLOPE: Methionine aminopeptidase (map) from Clostridium perfringens (strain 13 / Type A)

KEGG orthology group: K01265, methionyl aminopeptidase [EC: 3.4.11.18] (inferred from 70% identity to chu:CHU_3141)

Predicted SEED Role

"Methionine aminopeptidase (EC 3.4.11.18)" (EC 3.4.11.18)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.4.11.18

Use Curated BLAST to search for 3.4.11.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YX62 at UniProt or InterPro

Protein Sequence (257 amino acids)

>CA264_19450 type I methionyl aminopeptidase (Pontibacter actiniarum KMM 6156, DSM 19842)
MVFYKTEEEIELIRQSALILGKAHGEIARLIKPGVSTLALDKAAEEFIQDHGGKPSFKDY
NGFPYSLCISVNSVVVHGFPSNYTLNDGDVISVDCGVYKNGFHSDSAYTHAVGNVKPEVQ
KLLDVTKESLYKGIEKAVVGSRLGDVGFSIQEHAEAAGFTVVRELVGHGIGRSLHESPEV
PNYGKRGQGVKLQNGLVIAIEPMVNLGTRHIVQEEDGWTIRTKDNMPSAHFEHTVVVRKD
KAEILTTFEYIEQAKNS