Protein Info for CA264_19430 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: 30S ribosomal protein S5

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01021: ribosomal protein uS5
  • amino acids 15 to 167 (153 residues), 219.2 bits, E=1.2e-69
• PF00333: Ribosomal_S5
  • amino acids 16 to 80 (65 residues), 103.7 bits, E=4.2e-34
• PF03719: Ribosomal_S5_C
  • amino acids 92 to 162 (71 residues), 107.9 bits, E=1.4e-35

Best Hits

Swiss-Prot: 81% identical to RS5_CYTH3: 30S ribosomal protein S5 (rpsE) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K02988, small subunit ribosomal protein S5 (inferred from 82% identity to mtt:Ftrac_3049)

MetaCyc: 53% identical to 30S ribosomal subunit protein S5 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S5p (S2e)" in subsystem Ribosomal protein S5p acylation or Ribosome SSU bacterial

Sequence Analysis Tools

See A0A1X9YX22 at UniProt or InterPro

Protein Sequence (172 amino acids)

>CA264_19430 30S ribosomal protein S5 (Pontibacter actiniarum KMM 6156, DSM 19842)
MLKNNIRSVKASEIELKEKVVAINRVAKVVKGGRRFSFAAIVVVGDGNGVVGYGLGKANE
VTDAIAKGIDDAKKNLVKVPVYHNTVPHAIEGKYSGGFVLVKPAAPGTGVIAGGAMRAVL
ESAGIKDVLCKSKGSSNPHNVVKATFDALSKMRDPLAVAQQRGVNLQKVFNG