Protein Info for CA264_19240 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: UMP kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02075: UMP kinase
  • amino acids 3 to 234 (232 residues), 346 bits, E=5.1e-108
• PF00696: AA_kinase
  • amino acids 4 to 213 (210 residues), 115 bits, E=2.4e-37

Best Hits

Swiss-Prot: 74% identical to PYRH_CYTH3: Uridylate kinase (pyrH) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K09903, uridylate kinase [EC: 2.7.4.22] (inferred from 78% identity to shg:Sph21_1043)

MetaCyc: 56% identical to UMP kinase (Escherichia coli K-12 substr. MG1655)
Cytidylate kinase. [EC: 2.7.4.14, 2.7.4.22]

Predicted SEED Role

"Uridine monophosphate kinase (EC 2.7.4.22)" (EC 2.7.4.22)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
• superpathway of pyrimidine deoxyribonucleoside salvage (9/9 steps found)
• superpathway of pyrimidine ribonucleosides salvage (9/10 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (8/9 steps found)
• pyrimidine deoxyribonucleotide phosphorylation (4/4 steps found)
• superpathway of pyrimidine nucleobases salvage (4/4 steps found)
• UTP and CTP de novo biosynthesis (3/3 steps found)
• CMP phosphorylation (2/2 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.4.14

Use Curated BLAST to search for 2.7.4.14 or 2.7.4.22

Sequence Analysis Tools

See A0A1X9YXA8 at UniProt or InterPro

Protein Sequence (258 amino acids)

>CA264_19240 UMP kinase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKYKRILLKLSGEALMGEQQYGIDSNRLIQYAEEIKEVAALGVEVAVVIGGGNIFRGVQA
EQVGLDRVQGDYMGMLATVINSMALQSALEKLGVYTRLLSGINIQQVCEPYIRRRAVRHL
EKGRVVIFGAGTGNPYFTTDSAASLRAIEIEADVVLKGTRVDGIYSADPEKDPNAVFYSQ
ISFKDVFEQGLNVMDMTAFTLCKENDLPIIVFDMNTQGNLKRLVQGERVGTLVSMDDLGE
TLKETVDQMQSGPKGDKK