Protein Info for CA264_19230 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: nicotinate-nicotinamide nucleotide adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00125: cytidyltransferase-like domain
  • amino acids 3 to 68 (66 residues), 32.1 bits, E=1e-11
• TIGR00482: nicotinate (nicotinamide) nucleotide adenylyltransferase
  • amino acids 5 to 189 (185 residues), 173.9 bits, E=3.9e-55
• PF01467: CTP_transf_like
  • amino acids 6 to 163 (158 residues), 69.6 bits, E=1.5e-23

Best Hits

Swiss-Prot: 60% identical to NADD_CYTH3: Probable nicotinate-nucleotide adenylyltransferase (nadD) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K00969, nicotinate-nucleotide adenylyltransferase [EC: 2.7.7.18] (inferred from 62% identity to dfe:Dfer_3826)

Predicted SEED Role

"Nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.7.7.18)

MetaCyc Pathways

• NAD de novo biosynthesis II (from tryptophan) (9/9 steps found)
• NAD biosynthesis from 2-amino-3-carboxymuconate semialdehyde (4/4 steps found)
• NAD salvage pathway I (PNC VI cycle) (6/7 steps found)
• superpathway of NAD biosynthesis in eukaryotes (11/14 steps found)
• NAD salvage pathway II (PNC IV cycle) (4/5 steps found)
• NAD salvage pathway V (PNC V cycle) (4/5 steps found)
• NAD de novo biosynthesis I (4/6 steps found)
• NAD de novo biosynthesis III (4/6 steps found)
• NAD de novo biosynthesis IV (anaerobic) (4/6 steps found)
• aspartate superpathway (17/25 steps found)
• NAD salvage (plants) (6/11 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.18

Sequence Analysis Tools

See A0A1X9YX19 at UniProt or InterPro

Protein Sequence (190 amino acids)

>CA264_19230 nicotinate-nicotinamide nucleotide adenylyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKVGLLFGSFNPIHTGHLILANFMATNTDLDTVWLVVSPQNPFKPSNTLLHEFDRLHMVS
LAIADNPNLGVSNIEFSMPKPSYTIDTLTYLQEKYPSYEFVLIMGEDNLSLFPKWKNAES
ILAFHKVYVYPRSGSVTTELPDMPNVTFVKAPVLDISATFIRKCIREEKSIKYLVPDEVA
DYIQVHRLYQ